DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG9672

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:128/267 - (47%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68
            |.:.|:.:|        .||....|   :|||.||||..:|..|||.:|.. .||:.||..:|.:
  Fly     5 LTIGLILVA--------AGVLEAQP---QGRIAGGEDAVLGQLPYQAALSI-GGSYNCGAVIIGQ 57

  Fly    69 DTVVTAAHCLV--GRK---VSKVF-VRLGST-LYNEGGIVVAVRELAYNEDYNSKTMEYDVGILK 126
            ...:||..|:.  |:.   .:.:| |.:||. |||  |..:.|.|:..|.:|:  |::..:.:|:
  Fly    58 RYALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYN--GKQIRVEEITINPNYS--TLKTGIALLR 118

  Fly   127 LDEKVKETENIRYIELATETPPTGTTAVVTGWG----SKCYFWCMTLPKTLQEVYVNIVDWKTCA 187
            |.|::..:|.:..|.|:.:.||.|:...|:|||    |:     :.:.:|||.....::..:.||
  Fly   119 LQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESE-----VNMHRTLQIGAAEVMAPRECA 178

  Fly   188 ---SDEYKYGEIIYDSMVC-AYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDV 248
               .||....:   |.::| .:.:::..|.||.|||......|||:.:........:||..:..:
  Fly   179 LANRDELLVAD---DQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISI 240

  Fly   249 PALRKWI 255
            .|...||
  Fly   241 AANYDWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 68/235 (29%)
Tryp_SPc 35..255 CDD:238113 67/234 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 68/235 (29%)
Tryp_SPc 25..250 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.