DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG9673

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:275 Identity:77/275 - (28%)
Similarity:125/275 - (45%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVT 73
            :.|.:|....|.:..:...|   :|||:||||...|.:|:..|::... :|.|.|::|:.:.::|
  Fly     6 ITLGLGLLIFGLILSAEASP---QGRILGGEDVAQGEYPWSASVRYNK-AHVCSGAIISTNHILT 66

  Fly    74 AAHCL--VG---RKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            ||||:  ||   ...|.:.||||:.....||.:|.|:.:..:..|.:  ..:|:.||:|||.:..
  Fly    67 AAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGN--FLHDIAILELDETLVF 129

  Fly   134 TENIRYIELATETP----------PTGTTAVVTGWG-----------SKCYFWCMTLPKTLQEVY 177
            ::.|:.|.|...|.          |.||...|.|||           .|..:  .||.::|.|  
  Fly   130 SDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANY--NTLSRSLCE-- 190

  Fly   178 VNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDA-CQGDSGGPLAVGN-TLVGIVSWGYACASNL 240
                 |      |..||   |:|:||....:.:. |:||:|..:...: .|.|:.|:.:....:.
  Fly   191 -----W------EAGYG---YESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSK 241

  Fly   241 LPGVYSDVPALRKWI 255
            .|.|.:.|.....||
  Fly   242 YPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 70/248 (28%)
Tryp_SPc 35..255 CDD:238113 69/247 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/248 (28%)
Tryp_SPc 29..259 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.