DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and prss59.1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:263 Identity:92/263 - (34%)
Similarity:132/263 - (50%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67
            |.:|.||.|....|.             .:.:||||.:....:.|:|.||  .||.|||||||::
Zfish     2 RSLVFLVLLGAAFAL-------------DDDKIVGGYECQPNSQPWQASL--NSGYHFCGGSLVS 51

  Fly    68 EDTVVTAAHCLVGRKVSKVFVRLG--STLYNEG-GIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129
            |..||:||||.    .|:|.||||  :.:.||| ...:...::..|.:|:|..::.|:.::||.:
Zfish    52 EYWVVSAAHCY----KSRVEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSK 112

  Fly   130 KVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKT-----LQEVYVNIVDWKTCASD 189
            .....:.::.:.|.......||...|:|||:       |:..|     ||.:.:.|:..:.|.: 
Zfish   113 PATLNKYVQPVALPNGCAADGTMCRVSGWGN-------TMSSTADSNKLQCLEIPILSDRDCNN- 169

  Fly   190 EYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALR 252
              .|..:|.|:|.||  .|..||:||||||||:.....|.|||||||.||....||||..|....
Zfish   170 --SYPGMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFS 232

  Fly   253 KWI 255
            :||
Zfish   233 QWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 84/230 (37%)
Tryp_SPc 35..255 CDD:238113 84/229 (37%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 84/230 (37%)
Tryp_SPc 21..238 CDD:238113 86/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.