DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG32808

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:250 Identity:80/250 - (32%)
Similarity:124/250 - (49%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSL-QTKSGSHFCGGSLINEDTVVTAAHCLVGR 81
            ||..|        .:|:||.|.....|..|:.||| :.|||.|.||.:|:|...|:|||||:.|.
  Fly    21 AGASG--------EDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGS 77

  Fly    82 KVSKVFVRLGSTLYNEGGIVVA-VRELAYNEDYNSKTMEY--DVGILKLDEKVKETENIRYIEL- 142
            ...::.::.||.:.......|| |..:..:..|..:. :|  |:.:|:|.:.|..::.::.:.| 
  Fly    78 SPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPED-KYVNDIALLQLAQSVALSKFVQPVRLP 141

  Fly   143 -ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-- 204
             ..:..|...:||:.|||......  .:.:.||:|.:.:.....|:.....|   ::||.:||  
  Fly   142 EPRQVTPGNASAVLAGWGLNATGG--VVQQHLQKVKLQVFSDTECSERHQTY---LHDSQICAGL 201

  Fly   205 YEKKKDACQGDSGGPLAV--GNTLVGIVSWGY-ACASNLLPGVYSDVPALRKWIL 256
            .|..|..|.|||||||.:  .:|.||||||.. .||....|||:::|.|...||:
  Fly   202 PEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 74/231 (32%)
Tryp_SPc 35..255 CDD:238113 74/230 (32%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/231 (32%)
Tryp_SPc 30..258 CDD:238113 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.