DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG32755

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:289 Identity:96/289 - (33%)
Similarity:145/289 - (50%) Gaps:47/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAG----TVG--VSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKS------G-S 58
            |.:||.:.:..:|    .:|  .:...||....:||||...||...|:|||::.:|      | .
  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68

  Fly    59 HFCGGSLINEDTVVTAAHC--------LVGRKVSKVFVRLGSTLYNEGGIVV---AVRELAYNED 112
            |.|||::|::..|.:||||        ||.|......|..||:..:......   .|:.:..::|
  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133

  Fly   113 YNSKTMEYDVGILKLDEKVK-ETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPK---TL 173
            ||..|:|.|:.:|.|:..:. |:..:|.|.||.:.|..|||.::.|||.      :|:.:   :|
  Fly   134 YNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGK------VTMKEKSASL 192

  Fly   174 QEVYVNIVDWKTCASDEYKYGEIIYD---SMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWG 233
            |:..|.|::.:.|        ::||.   |.:||  .:...|||||||||||.....|.||:|||
  Fly   193 QQAPVPILNKELC--------QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG 249

  Fly   234 YACASNLLPGVYSDVPALRKWILNASETL 262
            ..||....||||::|....|||..|:.:|
  Fly   250 VGCADPGYPGVYTNVSHFLKWIRRANASL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/247 (34%)
Tryp_SPc 35..255 CDD:238113 85/246 (35%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/247 (34%)
Tryp_SPc 38..273 CDD:238113 87/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.