DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Klk15

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:268 Identity:82/268 - (30%)
Similarity:127/268 - (47%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70
            ||||..|           .:||      :::.||:....:.|:||:| .:.|...||..||:...
Mouse     8 VLLVSAA-----------QDGD------KVLEGEECVPHSQPWQVAL-FERGRFNCGAFLISPRW 54

  Fly    71 VVTAAHCLVGRKVSKVFVRLGS---TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVK 132
            |:|||||    :...:.||||.   ..::....:.:|..:..:..|.::|..:|:.:|:|.:..:
Mouse    55 VLTAAHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPAR 115

  Fly   133 ETENIRYIELATETPPTGTTAVVTGWG------------SKCYFWCMTLPKTLQEVYVNIVDWKT 185
            .|..:|.:.|....|..|...||:|||            .|.:   :.||.||....::|:...:
Mouse   116 LTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSH---VRLPDTLHCANISIISEAS 177

  Fly   186 CASDEYKYGEIIYDSMVCAYEK--KKDACQGDSGGPLAVGNTLVGIVSWG-YACASNLLPGVYSD 247
            |..|   |...:..:||||..:  ..|:|:|||||||..|..|.|||||| ..|.:...||||:.
Mouse   178 CNKD---YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTK 239

  Fly   248 VPALRKWI 255
            |.:..:||
Mouse   240 VCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 73/238 (31%)
Tryp_SPc 35..255 CDD:238113 73/237 (31%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.