DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG6041

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:138/288 - (47%) Gaps:49/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKS------GS-HFCGG 63
            :|.:.|.:|:..:|. .:|:....:.|.:||||.|.:|....||||::..:      || |.|||
  Fly     7 ILAIALFLGALASGE-SLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGG 70

  Fly    64 SLINEDTVVTAAHCLV------GRKVSKVFVRLGSTLY---NEGGIVVAVRELAYNEDYNSKTME 119
            .:|::..|.|||||..      .|...:..:.:|||..   .:..::..:::|..:|:||...:.
  Fly    71 VVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALT 135

  Fly   120 YDVGILKLDEKVK-ETENIRYIELATETPPTGTTAVVTGWG--------SKCYFWCMTLPKTLQE 175
            .|:.::.::..:. ....:..:.|.::...|.|..:::|||        |.         .|||.
  Fly   136 NDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSS---------NTLQA 191

  Fly   176 VYVNIVDWKTCASDEYKYGEIIYDSM----VCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGY 234
            ..|.||.:.||        .|.|:|:    |||  .....||||||||||::....|.||||:|.
  Fly   192 ATVPIVSYTTC--------RISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGA 248

  Fly   235 ACASNLLPGVYSDVPALRKWILNASETL 262
            .||:...||||::|.....||:..:.:|
  Fly   249 GCAAPGYPGVYTNVSYYYDWIVQKNSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/251 (30%)
Tryp_SPc 35..255 CDD:238113 76/250 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/251 (30%)
Tryp_SPc 35..272 CDD:238113 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.