DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:261 Identity:76/261 - (29%)
Similarity:110/261 - (42%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVCLAV-GSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQ--TKSGSHFCGGSLINED 69
            |.||.: |....|.|..|         :||||.:....:.||..|||  ...|||||||:||:..
  Rat   179 LPCLRLAGVRFHGAVQAS---------KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPR 234

  Fly    70 TVVTAAHCLVGRKVSKVFVRLGS--TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVK 132
            .|:||||||.......|.|.||:  .|.:|...........:..:||.:....||.:|:|:....
  Rat   235 FVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPAS 299

  Fly   133 ETENIRYIEL--ATETPPTGTTAVVTGW---GSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192
            ..:.:....|  ..::...||..:..||   |::.     ..|:.|.|:.|.:|.:         
  Rat   300 LGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRA-----PTPRVLHELNVTVVTF--------- 350

  Fly   193 YGEIIYDSMVCAYEKKKDA--CQGDSGGPLAVGNTLVGIVSWGY-ACASNLLPGVYSDVPALRKW 254
               :..:..||....::.|  |.|||||||.....|.|:.|:.. .|||...|..::.|.....|
  Rat   351 ---LCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNW 412

  Fly   255 I 255
            |
  Rat   413 I 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 67/232 (29%)
Tryp_SPc 35..255 CDD:238113 67/231 (29%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.