DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and LOC312273

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:242 Identity:82/242 - (33%)
Similarity:117/242 - (48%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKV 83
            |||.....:  :.:.|||||......:.||||||  .:|||.||||||.:..|::||||.    .
  Rat    11 GTVAAFPTE--DNDDRIVGGYTCQEHSVPYQVSL--NAGSHICGGSLITDQWVLSAAHCY----H 67

  Fly    84 SKVFVRLGS-TLYNEGGI--VVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATE 145
            .::.||||. .:|...|.  .:...::..:.||:..|::.|:.::||.........:..|.|...
  Rat    68 PQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQY 132

  Fly   146 TPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKK 208
            .|..||..:|:|||...:.:  ..|..||.:...::....|   ...|...|.::|.|.  .|..
  Rat   133 CPTAGTECLVSGWGVLKFGF--ESPSVLQCLDAPVLSDSVC---HKAYPRQITNNMFCLGFLEGG 192

  Fly   209 KDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ||:||.|||||:.....:.||||||..||....||||:.|.....||
  Rat   193 KDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 77/225 (34%)
Tryp_SPc 35..255 CDD:238113 76/224 (34%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 78/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.