DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG3795

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:290 Identity:81/290 - (27%)
Similarity:125/290 - (43%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGR-------IVGG-EDTTIGAHPYQVSLQTK------S 56
            :||:.::..|......|..:..|.:|:.|       :.|| ...|.....|.|||:..      .
  Fly    10 ILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFG 74

  Fly    57 GSHFCGGSLINEDTVVTAAHCLVGR----KVSKVFVRLGS---TLYNEGGIVVAVRELAYNEDY- 113
            .:|||.|::.:|..::|||||:...    |..|:.|..|:   .|.:....::...||..:..| 
  Fly    75 DNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYK 139

  Fly   114 NSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFW----------CMT 168
            ..|:.:||:|::.|:..:...:.:..|.|..:.|..|....:.|||:...|.          ...
  Fly   140 KGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQI 204

  Fly   169 LPKTLQEVYVNIVDWKT----CASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGI 229
            ||.|..|   .::.|..    ||:|:       :||.|       |:|||||||||...|.:.||
  Fly   205 LPDTFCE---KLLGWSNAGMLCANDK-------HDSDV-------DSCQGDSGGPLICDNMVTGI 252

  Fly   230 VSWGYACASNLLPGVYSDVPALRKWILNAS 259
            ||:|..|......|:|:||...|.||...|
  Fly   253 VSFGMGCGEPDSAGIYTDVYHFRDWITENS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 72/256 (28%)
Tryp_SPc 35..255 CDD:238113 71/248 (29%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 70/237 (30%)
Tryp_SPc 60..278 CDD:214473 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.