DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG14780

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:269 Identity:93/269 - (34%)
Similarity:125/269 - (46%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQ-----TKSGS-HFCGGSLINEDTVVTA 74
            |||......|     ::.||:.|.........:.||::     ...|| |.|||:||....|:||
  Fly    19 ACAAADLQEN-----QQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTA 78

  Fly    75 AHCLVG------RKVSKVFVRLGSTL----YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129
            ||||..      |:.|:..|.|| ||    :..|.||..|..:||...::..:|..|||||.|..
  Fly    79 AHCLYNNQRKRFRRASEFVVVLG-TLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRT 142

  Fly   130 KVKETE------NIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS 188
            .:..:.      .:..|:||.:..|.|....|.|||           :|.|....||:.....::
  Fly   143 GLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWG-----------RTEQSSLSNILLTANVST 196

  Fly   189 DEYKYGEIIYDS-----MVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYS 246
            ..::...:||.|     |:||  .:...|:|||||||||.....|||:|||||.||...|||||.
  Fly   197 IRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYV 261

  Fly   247 DVPALRKWI 255
            ||...|:||
  Fly   262 DVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 87/249 (35%)
Tryp_SPc 35..255 CDD:238113 86/248 (35%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 87/249 (35%)
Tryp_SPc 33..271 CDD:238113 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.