DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Klk14

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:264 Identity:91/264 - (34%)
Similarity:129/264 - (48%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHF-CGGSLINEDT 70
            :|:.|.:..|.|..:..|.||     .:|:||......:.|:||:||...|..| |||.|:::..
  Rat    61 MLLLLTILQALAVAIVQSQGD-----DKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQW 120

  Fly    71 VVTAAHCLVGRKVSKVFVRLGSTLYN------EGGIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129
            |:|||||  .|.:  :.|.||.  :|      ...::..||::.:.: |..:..:.|:.:|||..
  Rat   121 VITAAHC--ARPL--LHVALGK--HNLRRWEATQQVLRVVRQVPHPQ-YRPQAHDNDLMLLKLQR 178

  Fly   130 KVKETENIRYIELATETPPTGTTAVVTGWGSKC-----YFWCMTLPKTLQEVYVNIVDWKTCASD 189
            ||:....:|.|.:|......||...|:|||:..     |      |..||.|.|||:..:.|   
  Rat   179 KVRLGRAVRTIPVARSCASPGTPCRVSGWGTTASPIVRY------PTALQCVNVNIMPEQVC--- 234

  Fly   190 EYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGY-ACASNLLPGVYSDVPAL 251
            ...|...|...||||  .|..||:|||||||||.....|.|:||||. .||....||||:::...
  Rat   235 HRAYPGTITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNY 299

  Fly   252 RKWI 255
            ..||
  Rat   300 HSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/235 (35%)
Tryp_SPc 35..255 CDD:238113 82/234 (35%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.