DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:266 Identity:87/266 - (32%)
Similarity:122/266 - (45%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAVGSAC----------AGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            :|:|..|          .|...||:..     .|||||.....||.|:|.||:.:. .|.|||||
  Rat     1 MALGPYCGFLLLLAVPGCGQPQVSHAG-----SRIVGGHAAQAGAWPWQASLRLQK-VHVCGGSL 59

  Fly    66 INEDTVVTAAHCLVGRKVSKVF-VRLGSTLYNEGGIVVAVRE-LAYNEDYNSKTMEYDVGILKLD 128
            ::.:.|:|||||..|...|..: |.||............|:: :.|:..........|:.:::|.
  Rat    60 LSPEWVLTAAHCFSGSVNSSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLA 124

  Fly   129 EKVKETENIRYI---ELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDE 190
            ..|..:..::.:   |.:.:..| |....|||||.......:..|..|||..|::||.:|| |..
  Rat   125 TPVALSSQVQPVCLPEASADFHP-GMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETC-SQA 187

  Fly   191 Y--KYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLV----GIVSWGYACASNLLPGVYSDVP 249
            |  ..|.:|...|:||: ...||||.||||||......:    |:||||..|.....||||:.|.
  Rat   188 YSSSNGSLIQSDMLCAW-GPGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVT 251

  Fly   250 ALRKWI 255
            |...||
  Rat   252 AYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 79/231 (34%)
Tryp_SPc 35..255 CDD:238113 78/230 (34%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 79/231 (34%)
Tryp_SPc 30..260 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.