DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and HABP2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:269 Identity:84/269 - (31%)
Similarity:119/269 - (44%) Gaps:78/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTK-------SGSHFCGGSLINEDTVVTAAHC----------LVGR 81
            ||.||..:|.|.||:|.|||:.       ...|||||:||:...|:|||||          ::|.
Human   313 RIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKTRHLKVVLGD 377

  Fly    82 -------------KVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKL----DE 129
                         :|.|:|   ..:.|||..      |:.:|          |:.:|||    ..
Human   378 QDLKKEEFHEQSFRVEKIF---KYSHYNERD------EIPHN----------DIALLKLKPVDGH 423

  Fly   130 KVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKT------LQEVYVNIVDWKTCAS 188
            ...|::.::.:.|...:.|:|:...::|||         :.:|      |.:..|.::....|.|
Human   424 CALESKYVKTVCLPDGSFPSGSECHISGWG---------VTETGKGSRQLLDAKVKLIANTLCNS 479

  Fly   189 DEYKYGEIIYDSMVCAYEKKK---DACQGDSGGPLAV---GNTLV-GIVSWGYACASNLLPGVYS 246
            .:. |..:|.|||:||...:|   |.|||||||||..   |...| ||||||..|...  ||||:
Human   480 RQL-YDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKR--PGVYT 541

  Fly   247 DVPALRKWI 255
            .|.....||
Human   542 QVTKFLNWI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/267 (31%)
Tryp_SPc 35..255 CDD:238113 81/266 (30%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 83/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.