DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and HABP2

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:269 Identity:84/269 - (31%)
Similarity:119/269 - (44%) Gaps:78/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTK-------SGSHFCGGSLINEDTVVTAAHC----------LVGR 81
            ||.||..:|.|.||:|.|||:.       ...|||||:||:...|:|||||          ::|.
Human   313 RIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKTRHLKVVLGD 377

  Fly    82 -------------KVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKL----DE 129
                         :|.|:|   ..:.|||..      |:.:|          |:.:|||    ..
Human   378 QDLKKEEFHEQSFRVEKIF---KYSHYNERD------EIPHN----------DIALLKLKPVDGH 423

  Fly   130 KVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKT------LQEVYVNIVDWKTCAS 188
            ...|::.::.:.|...:.|:|:...::|||         :.:|      |.:..|.::....|.|
Human   424 CALESKYVKTVCLPDGSFPSGSECHISGWG---------VTETGKGSRQLLDAKVKLIANTLCNS 479

  Fly   189 DEYKYGEIIYDSMVCAYEKKK---DACQGDSGGPLAV---GNTLV-GIVSWGYACASNLLPGVYS 246
            .:. |..:|.|||:||...:|   |.|||||||||..   |...| ||||||..|...  ||||:
Human   480 RQL-YDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKR--PGVYT 541

  Fly   247 DVPALRKWI 255
            .|.....||
Human   542 QVTKFLNWI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/267 (31%)
HABP2NP_004123.1 EGF 77..106 CDD:394967
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 83/268 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.