DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:260 Identity:88/260 - (33%)
Similarity:121/260 - (46%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLV-- 79
            |.||   .......:..|||||.:...|..|:|.|||. .|||.||.:|||...:|:||||..  
Human   177 CCGT---RRSKTLGQSLRIVGGTEVEEGEWPWQASLQW-DGSHRCGATLINATWLVSAAHCFTTY 237

  Fly    80 ---GRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYI- 140
               .|..:...|.:..:....|     :|.:..:|.|...:.:||:.:.:|...|..|..:..: 
Human   238 KNPARWTASFGVTIKPSKMKRG-----LRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVC 297

  Fly   141 --ELATETPPTGTTAVVTGWGSKCYFWCMTLPKT------LQEVYVNIVDWKTCASDEYKYGEII 197
              :.:.|..| |....|||:|:        |...      |::..|.::|..|| ::...|.:.|
Human   298 LPDASYEFQP-GDVMFVTGFGA--------LKNDGYSQNHLRQAQVTLIDATTC-NEPQAYNDAI 352

  Fly   198 YDSMVCA--YEKKKDACQGDSGGPLAVGNT-----LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ...|:||  .|.|.|||||||||||...:.     |.||||||..||....||||:.|.|||.||
Human   353 TPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWI 417

  Fly   256  255
            Human   418  417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 83/241 (34%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 84/242 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.