DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and KLK9

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:275 Identity:81/275 - (29%)
Similarity:126/275 - (45%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSH----FCGGS 64
            |:..|:.|..|...|.|             |.:|.|:....:.|:|..|     .|    |||.:
Human     5 LLCALLSLLAGHGWADT-------------RAIGAEECRPNSQPWQAGL-----FHLTRLFCGAT 51

  Fly    65 LINEDTVVTAAHCLVGRKVSKVFVRLGS-TLYNEGGIVVAVR------ELAYNEDYNSKTMEYDV 122
            ||::..::|||||   || ..::||||. .|:...|.....|      ...:|:|.::.....|:
Human    52 LISDRWLLTAAHC---RK-PYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDI 112

  Fly   123 GILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGS----KCYFWCMTLPKTLQEVYVNIVDW 183
            .:::|..:.:.:..::.:.|:......|...:::|||:    |..|     |.|||...::|::.
Human   113 MLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALF-----PVTLQCANISILEN 172

  Fly   184 KTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWG-YACASNLLPGVY 245
            |.|   .:.|...|.|||:||  :|..:.:|||||||||....||.|:||.| ..|:....|.||
Human   173 KLC---HWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVY 234

  Fly   246 SDVPALRKWILNASE 260
            :.|.....||....|
Human   235 TSVCHYLDWIQEIME 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 72/238 (30%)
Tryp_SPc 35..255 CDD:238113 71/237 (30%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.