DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:253 Identity:91/253 - (35%)
Similarity:117/253 - (46%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL 78
            ||.| |...|||..     .|||||.....|..|:|.||:... .|.|||||::.:.|:|||||.
Mouse    72 GSGC-GHPQVSNSG-----SRIVGGHAAPAGTWPWQASLRLHK-VHVCGGSLLSPEWVLTAAHCF 129

  Fly    79 VGRKVSKVF-VRLGS-TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYI- 140
            .|...|..: |.||. |:..........|.:.|...........|:.:::|...|..:..::.: 
Mouse   130 SGSVNSSDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVC 194

  Fly   141 --ELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK--YGEIIYDSM 201
              |.:.:..| |....|||||.......:..|..|||..|::||.||| |..|.  .|.:|...|
Mouse   195 LPEASADFYP-GMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTC-SQAYNSPNGSLIQPDM 257

  Fly   202 VCAYEKKKDACQGDSGGPLA--VGNT--LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            :|| ....||||.||||||.  |..|  ..|:||||..|.....||||:.|.|...||
Mouse   258 LCA-RGPGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/231 (35%)
Tryp_SPc 35..255 CDD:238113 81/230 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 83/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.