DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and TPSG1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:266 Identity:91/266 - (34%)
Similarity:123/266 - (46%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSACAGTVGVSNGDP------------FEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLI 66
            |.:..|.:|...|.|            .:..||||||.....||.|:|.||:.:. .|.|||||:
Human    30 GGSAVGFLGSPPGTPSSFDLGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRR-VHVCGGSLL 93

  Fly    67 NEDTVVTAAHCLVGRKVSKVF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKT-MEYDVGILKLDE 129
            :...|:|||||..|...|..: |.||............||::..:...:.:. ...|:.:::|..
Human    94 SPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSV 158

  Fly   130 KVKETENIRYIEL--ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192
            .|..:..|..:.|  |::....|....|||||.......:..|.:|:||.|::||.:||..|   
Human   159 PVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRD--- 220

  Fly   193 Y----GEIIYDSMVCAYEKKKDACQGDSGGPLA--VGNTLV--GIVSWGYACASNLLPGVYSDVP 249
            |    |.|:...|:|| ....||||.||||||.  |....|  |.||||..|.....||||:.||
Human   221 YPGPGGSILQPDMLCA-RGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVP 284

  Fly   250 ALRKWI 255
            |...||
Human   285 AYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 83/232 (36%)
Tryp_SPc 35..255 CDD:238113 82/231 (35%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 83/232 (36%)
Tryp_SPc 63..293 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.