DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:260 Identity:98/260 - (37%)
Similarity:131/260 - (50%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            ||....||:|.|        .|.:.:.:||||......:.||||||  .||.|||||||||:..|
  Rat     4 LLFLALVGAAVA--------FPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWV 58

  Fly    72 VTAAHCLVGRKVSKVFVRLGSTLYN--EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            |:||||.    .|::.||||....|  ||. ..|...::..:.:::.||:..|:.::||...||.
  Rat    59 VSAAHCY----KSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYK 192
            ...:..:.|.:...|.||..:::|||:       ||      |..||.:...::....|   |..
  Rat   120 NARVATVALPSSCAPAGTQCLISGWGN-------TLSSGVNEPDLLQCLDAPLLPQADC---EAS 174

  Fly   193 YGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |...|.|:|||.  .|..||:||||||||:.....|.|||||||.||....||||:.|.....||
  Rat   175 YPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

  Fly   256  255
              Rat   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 89/231 (39%)
Tryp_SPc 35..255 CDD:238113 89/230 (39%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 89/231 (39%)
Tryp_SPc 24..242 CDD:238113 91/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.