DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tmprss11f

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:254 Identity:85/254 - (33%)
Similarity:126/254 - (49%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTI-GAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL-VGRKVSKVFVRLGSTL-- 94
            |||.|.:|.: |..|:|.|||.....|.||.:||:...::|||||. ..|..:|..|..|:|:  
Mouse   206 RIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLTAAHCFWKNRDPTKWIVTFGTTITP 270

  Fly    95 ----YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYI---ELATETPPTGTT 152
                .:.|.|::       :|:|:..|.|.|:.:.:|..:|:.:..::.:   :.:.:.||. |:
Mouse   271 PLVKRSVGKIII-------HEEYHRDTNENDIALAQLTTRVEFSNVVQRVCLPDSSMKLPPK-TS 327

  Fly   153 AVVTGWGS---------KCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA--YE 206
            ..|||:||         |           |::..|..:....|...:. |..:|...|:||  .|
Mouse   328 VFVTGFGSIVDDGPTQNK-----------LRQARVETIGSDVCNRKDV-YDGLITPGMLCAGFME 380

  Fly   207 KKKDACQGDSGGPLAVGNT----LVGIVSWGYACASNLLPGVYSDVPALRKWILNASET 261
            .|.|||:|||||||...|.    :|||||||.:||....||||:.|...|.||  ||:|
Mouse   381 GKIDACKGDSGGPLVYDNRDIWYIVGIVSWGQSCALPNKPGVYTRVTKYRDWI--ASKT 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/246 (33%)
Tmprss11fNP_848845.1 SEA 60..159 CDD:460188
Tryp_SPc 207..436 CDD:238113 82/250 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.