DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:262 Identity:98/262 - (37%)
Similarity:132/262 - (50%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            ||:...||:|.|        .|.:.:.:||||......:.||||||  .:|.|||||||||:..|
Mouse     4 LLILALVGAAVA--------FPVDDDDKIVGGYTCRESSVPYQVSL--NAGYHFCGGSLINDQWV 58

  Fly    72 VTAAHCLVGRKVSKVFVRLGSTLYN--EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            |:||||...|    :.||||....|  ||. ..|...::..:.:|||.|::.|:.::||...|..
Mouse    59 VSAAHCYKYR----IQVRLGEHNINVLEGNEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTL 119

  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYK 192
            ...:..:.|.:...|.||..:::|||:       ||      |..||.|...::....|   |..
Mouse   120 NARVASVPLPSSCAPAGTQCLISGWGN-------TLSNGVNNPDLLQCVDAPVLPQADC---EAS 174

  Fly   193 YGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |...|.::|:|.  .|..||:||||||||:.....|.|||||||.||....||||:.|.....||
Mouse   175 YPGDITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWI 239

  Fly   256 LN 257
            .|
Mouse   240 QN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 88/231 (38%)
Tryp_SPc 35..255 CDD:238113 88/230 (38%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 88/231 (38%)
Tryp_SPc 24..242 CDD:238113 91/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.