DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss38

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:119/261 - (45%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL-VGRKVSKV 86
            |:.|.|. .:|:::|||.......|:||||. .||.|.||||:::...|::||||. .|:|:...
Mouse    45 VACGQPV-LQGKLLGGEFARDRKWPWQVSLH-YSGFHICGGSILSAYWVLSAAHCFDRGKKLETY 107

  Fly    87 FVRLGSTLYNEGGIVVAVRELAYNEDYN---SKTMEY------DVGILKLDEKVKETENIRYIEL 142
            .:.:|.|     .:..|.|...:.|.|.   ..|.:.      ||.:::|...:..::.:..|.|
Mouse   108 DIYVGIT-----NLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFVLPICL 167

  Fly   143 ATETPPTGTTAV-----VTGWGSKCYFWCMTLPK-----TLQEVYVNIVDWKTCASDEYKYG--E 195
                ||:....:     .||||       |..|:     .|.|..:.::....|   :..||  .
Mouse   168 ----PPSDLYLINLSCWTTGWG-------MISPQGETGNELLEAQLPLIPRFQC---QLLYGLSS 218

  Fly   196 IIYDSMVCAYEKK--KDACQGDSGGPLAVGNT----LVGIVSWGYACASNLLPGVYSDVPALRKW 254
            .:...|:||.:.|  |:.|:||||.||.....    .:||||||..||..|.|||:::|.....|
Mouse   219 YLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSW 283

  Fly   255 I 255
            |
Mouse   284 I 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 72/248 (29%)
Tryp_SPc 35..255 CDD:238113 72/247 (29%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 74/247 (30%)
Tryp_SPc 58..284 CDD:214473 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.