DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and try-1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:233 Identity:83/233 - (35%)
Similarity:120/233 - (51%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLV-GRKVSKVFVRLGSTLYNE 97
            |::||.:::..:.|:.|.|.::.|.|.||||||:.:.|:|||||.. .|:.:...||:|......
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGS 121

  Fly    98 GG----IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGW 158
            |.    ..|::... ||..:.|   .||..|:::...|..:...|.|.|.:.........|||||
 Worm   122 GSPHRVTAVSIHPW-YNIGFPS---SYDFAIMRIHPPVNTSTTARPICLPSLPAVENRLCVVTGW 182

  Fly   159 GSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-YEKKK-DACQGDSGGPLA 221
            ||......::.| ||:|::|.::....|:|.....|.|...||:|| |...| |:|||||||||.
 Worm   183 GSTIEGSSLSAP-TLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLM 246

  Fly   222 VGN----TLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ...    .|.|:||||..||...:||||.:|.:...||
 Worm   247 CARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 81/231 (35%)
Tryp_SPc 35..255 CDD:238113 80/230 (35%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 82/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.