DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:275 Identity:97/275 - (35%)
Similarity:144/275 - (52%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSG--SHFCGG 63
            :.||::||..|::    ..::..|...|..:...||||.:.:....|:||||:.|..  .|||||
Mouse     2 LKRLLLLLWALSL----LASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGG 62

  Fly    64 SLINEDTVVTAAHCLVGR--KVSKVF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGIL 125
            |||:...|:||||| ||.  |..::| |:|.......|..::::..:..:..|.:.....||.:|
Mouse    63 SLIHPQWVLTAAHC-VGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALL 126

  Fly   126 KLDEKVKETENIRYIEL--ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS 188
            :|:..|..:.::..|.|  |:||.|.||:..|||||.......:..|..|::|.|.||:...|  
Mouse   127 ELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLC-- 189

  Fly   189 DEYKY------GE---IIYDSMVCAYEKKKDACQGDSGGPLAV---GNTL-VGIVSWGYACASNL 240
             :.||      |:   |::|.|:||...::|:|||||||||..   |..| .|:||||..||...
Mouse   190 -DRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPN 253

  Fly   241 LPGVYSDVPALRKWI 255
            .||:|:.|.....||
Mouse   254 KPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 88/240 (37%)
Tryp_SPc 35..255 CDD:238113 88/239 (37%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.