DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and F10

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:244 Identity:84/244 - (34%)
Similarity:116/244 - (47%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEG 98
            |||||.:...|..|:|..|..:....||||:::||..::||||||...:..||.|...:|...||
Mouse   243 RIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAHCLHQARRFKVRVGDRNTEKEEG 307

  Fly    99 G-----IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIR-----YIELATETPPTGTTA 153
            .     :.|.::...:..|    |.:||:.:|:|...:....|:.     ..:.|..|..|..|.
Mouse   308 NEMVHEVDVVIKHNKFQRD----TYDYDIAVLRLKTPITFRMNVAPACLPQKDWAESTLMTQKTG 368

  Fly   154 VVTGWGSKCYFWCMTLPK-----TLQEVYVNIVDWKTC-ASDEYKYGEIIYDSMVCA-YEKK-KD 210
            :|:|:|       .|..|     .|:.:.|..||..|| .|..:.    |..:|.|| ||.| :|
Mouse   369 IVSGFG-------RTHEKGRQSNILKMLEVPYVDRNTCKLSTSFS----ITQNMFCAGYEAKLED 422

  Fly   211 ACQGDSGGP--LAVGNT--LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |||||||||  ....||  :.||||||..||.....|:|:.|....|||
Mouse   423 ACQGDSGGPHVTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/242 (34%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:464251
Tryp_SPc 244..473 CDD:238113 83/243 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.