DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and TMPRSS11B

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:231 Identity:87/231 - (37%)
Similarity:129/231 - (55%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEG 98
            :||.|:.:..||.|:|.|:|.| |.|:||.|||:...:::||||...:..||.:......:.|:.
Human   184 KIVNGKSSLEGAWPWQASMQWK-GRHYCGASLISSRWLLSAAHCFAKKNNSKDWTVNFGIVVNKP 247

  Fly    99 GIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL--ATETPPTGTTAVVTGWGSK 161
            .:...|:.:.::|:|:|..:..|:.:::|.|:|..||.||.|.|  |..........||||||: 
Human   248 YMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWGT- 311

  Fly   162 CYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGN 224
             .:...:.|..|||.::.|:|.|.| :..|.|...:.|:|:||  ...:.||||.|||||||..:
Human   312 -LYMNGSFPVILQEDFLKIIDNKIC-NASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPLAYPD 374

  Fly   225 T-----LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            :     ||||||||..|.....||||:.|.:.|.||
Human   375 SRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/229 (37%)
TMPRSS11BNP_872308.2 SEA 45..142 CDD:460188
Tryp_SPc 185..413 CDD:238113 87/230 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.