DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss29

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:268 Identity:93/268 - (34%)
Similarity:133/268 - (49%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQT-----KSGSHFCGGSLIN 67
            |.|...|:...|..||..|        ||||.....|..|:||||:.     ....|.||||:|:
Mouse    12 LGCSIAGTPAPGPEGVLMG--------IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIH 68

  Fly    68 EDTVVTAAHCLVGRKVS-KVF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130
            ...|:|||||:..|... .|| :|:|......|..:::|..:..:.|:....:..||.:|:|...
Mouse    69 PQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVS 133

  Fly   131 VKETENIRYIELATETPPTGTTAV--VTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTC------A 187
            |:...|::.::|.:|:.......|  |||||:......:..|..||:|.|.|:|...|      |
Mouse   134 VQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNA 198

  Fly   188 SDEYKYGE-IIYDSMVCAYEKKKDACQGDSGGPL---AVGN-TLVGIVSWGYACASNLLPGVYSD 247
            :.....|: :|...|:||..:.:|:|.|||||||   ..|: ||||:|||||.||....||||:.
Mouse   199 TRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYAR 263

  Fly   248 VPALRKWI 255
            |.:...||
Mouse   264 VQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 84/240 (35%)
Tryp_SPc 35..255 CDD:238113 84/239 (35%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 86/241 (36%)
Tryp_SPc 31..271 CDD:214473 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.