DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss28

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:282 Identity:84/282 - (29%)
Similarity:136/282 - (48%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSL-----QTKSGSHF 60
            |.||::|.:.....:....:|.:|...|.    .||||:.|..|..|:||||     :..|..|.
Mouse     1 MFRLLLLALSCLESTVFMASVSISRSKPV----GIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHI 61

  Fly    61 CGGSLINEDTVVTAAHCLVGR---------KVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSK 116
            ||||:|:...::|||||:..:         :|.:|::.....|.|...|::       :.|||..
Mouse    62 CGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIII-------HPDYNDV 119

  Fly   117 TMEYDVGILKLDEKVKETENIRYIELATETPPTGTT--AVVTGWGSKCYFWCMTLPKTLQEVYVN 179
            :..:|:.:::|...:..:.|:..:.|..::....:|  ..:.|||:......:..|..|.||.:.
Mouse   120 SKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIP 184

  Fly   180 IVDWKTC-------ASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNT----LVGIVSWG 233
            |.|.|:|       :|||:| ...|:|.|:||....:..|.|||||||....:    .||:||.|
Mouse   185 IQDNKSCKRAYRKKSSDEHK-AVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKG 248

  Fly   234 YACASNLLPGVYSDVPALRKWI 255
            ..|::| ||.::|.|.:...||
Mouse   249 IDCSNN-LPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 75/247 (30%)
Tryp_SPc 35..255 CDD:238113 75/246 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 77/248 (31%)
Tryp_SPc 31..269 CDD:214473 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5902
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.