DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and LOC100498083

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:267 Identity:91/267 - (34%)
Similarity:130/267 - (48%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70
            :||:|:.:|:|.|          |: :.:|:||......:.||.|||  .:|.|||||||||...
 Frog     3 LLLICVLLGAAAA----------FD-DDKIIGGATCAKNSVPYIVSL--NAGYHFCGGSLINNQW 54

  Fly    71 VVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRE----------LAYNEDYNSKTMEYDVGIL 125
            ||:||||.    .:.|.||||.  :|     :||.|          :..:..|||:|::.|:.::
 Frog    55 VVSAAHCY----QASVQVRLGE--HN-----IAVSEGTEQFINSAKVIRHSGYNSRTLDNDIMLI 108

  Fly   126 KLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKC-----YFWCMTLPKTLQEVYVNIVDWKT 185
            ||.........:..:.|.:.....||:.:::|||:..     |      |..||.:...|:....
 Frog   109 KLSSAASLNSAVNAVALPSSCAAAGTSCLISGWGNTSASGSNY------PNLLQCLNAPILTTAQ 167

  Fly   186 CASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDV 248
            |:.   .|...|.::|.||  .|..||:||||||||:.....|.||||||..||....||||:.|
 Frog   168 CSG---AYPGQITNNMFCAGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRNYPGVYTKV 229

  Fly   249 PALRKWI 255
            .....||
 Frog   230 CNYNSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/237 (35%)
Tryp_SPc 35..255 CDD:238113 82/236 (35%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.