DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and zgc:171509

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:263 Identity:86/263 - (32%)
Similarity:125/263 - (47%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            |:.:|.:|:        .|.|..|.||      :|:||.:....:.|:|..|.  .|...|||||
Zfish     1 MNSIVFILL--------IGVVVHSKGD------KIIGGHECQPHSQPWQARLD--DGYGLCGGSL 49

  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGS---TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKL 127
            |:|..||:||||    |.|.:.|.||.   .:..:....:...::..:..||::....|:.::||
Zfish    50 IHESWVVSAAHC----KSSSIIVHLGKHDLFVVEDTAQEIQAEKVISHPKYNNREHNNDIMLIKL 110

  Fly   128 DEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMT---LPKTLQEVYVNIVDWKTCASD 189
            .|......|::.:.|.|.....|...:|:|||       :|   :..|||.:.:.|:....|.| 
Zfish   111 REPAVINNNVKPVPLPTNCSHAGEQCLVSGWG-------VTGDSISSTLQCLELPILSKADCKS- 167

  Fly   190 EYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALR 252
              .||.:|...|.||  .:..||:||||||||:....||.||||:|..||....||||.:|....
Zfish   168 --AYGRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYI 230

  Fly   253 KWI 255
            .||
Zfish   231 NWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/228 (33%)
Tryp_SPc 35..255 CDD:238113 76/227 (33%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 76/228 (33%)
Tryp_SPc 21..234 CDD:238113 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.