DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and zgc:165423

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:267 Identity:92/267 - (34%)
Similarity:136/267 - (50%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68
            |:.::..|:.|..|..|.............:||||.:.:.|:.|:|.||. :|||||||||||::
Zfish     7 LLCVVTLLSTGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLH-ESGSHFCGGSLISD 70

  Fly    69 DTVVTAAHCLVGR-KVSKVFVRLG---STLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129
            ..:::||||.... ..|...|.||   ..|.|...:..:|.::..:..|...|.:.|:.:|.|..
Zfish    71 QWILSAAHCFPSNPNPSDYTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSS 135

  Fly   130 KVKETENIRYIELATETPPTGTTAV-----VTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASD 189
            .|..:..|:.:.||.:    |:|..     :||||:......:..|:.||||.|.||....| :.
Zfish   136 PVTFSNYIQPVCLAAD----GSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLC-NC 195

  Fly   190 EYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVG--NTLV--GIVSWGYACASNLLPGVYSDV 248
            .|..|..|.::|:||  .:..||:||||||||:.:.  ||.|  |:||:|..||....||||:.|
Zfish   196 LYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARV 260

  Fly   249 PALRKWI 255
            ...:.||
Zfish   261 SQYQNWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/235 (36%)
Tryp_SPc 35..255 CDD:238113 85/234 (36%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 85/235 (36%)
Tryp_SPc 38..269 CDD:238113 87/236 (37%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.