DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Gm10334

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:131/253 - (51%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVV 72
            |:...||:|.|        .|.:.:.:||||......:.||||||  .||.|||||||||:..||
Mouse     5 LILALVGAAVA--------FPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWVV 59

  Fly    73 TAAHCLVGRKVSKVFVRLGSTLYN--EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKET 134
            :||||.    .:::.||||....|  ||. ..|...::..:.::|.||:..|:.::||...|...
Mouse    60 SAAHCY----KTRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLN 120

  Fly   135 ENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYD 199
            ..:..:.|.:...|.||..:::|||:...|. ::.|..||.:...::....|   |..|...|..
Mouse   121 ARVATVALPSSCAPAGTQCLISGWGNTLSFG-VSEPDLLQCLDAPLLPQADC---EASYPGKITG 181

  Fly   200 SMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            :||||  .|..||:||||||||:.....|.|||||||.||....||||:.|.....||
Mouse   182 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 87/225 (39%)
Tryp_SPc 35..255 CDD:238113 87/224 (39%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 89/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.