DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and gzm3.3

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:276 Identity:80/276 - (28%)
Similarity:119/276 - (43%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68
            |...|:.||:  :.||  |:.:|        |:||:.....:.||..|:|... .|.|||.||.:
Zfish     3 LCTFLLLLAI--SLAG--GMDSG--------IIGGKVAKAHSRPYMASIQINK-HHTCGGMLIRD 54

  Fly    69 DTVVTAAHCL-----VGRKVSKVFV---RLGSTLYNEGGIVVA--VRELAYNEDYNSKTMEYDVG 123
            |.|:||||||     .||...:|.:   .:.....|:..|.|.  :|...:..: ..|...||:.
Zfish    55 DYVLTAAHCLNRGVYSGRGHLEVVLGAHNISKHEQNQQRIQVKKYIRHPMFQRN-KEKDYSYDIM 118

  Fly   124 ILKLDEKVKETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMTLPK------TLQEVYVNI 180
            :|||..|.|.::.::.|.|..:..  |......|.|||       :|.||      .|:||.:.:
Zfish   119 LLKLKNKAKISKFVKVISLPKKNGKIPANVKCSVAGWG-------LTKPKAELASDVLEEVTLKL 176

  Fly   181 ---VDWKTCASDEYKYGEIIYDSMVCAYEKKKDA-CQGDSGGPLAVGNTLVGIVSWGYA--CASN 239
               .:.||.....:.     .:.|:|:....|.| |||||||||........|||:.:.  |.:.
Zfish   177 QFDFECKTMWQQHFN-----TERMICSVSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGNCINK 236

  Fly   240 LLPGVYSDVPALRKWI 255
            ..|.|:..:.....||
Zfish   237 QYPQVFLKISYFLPWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 70/244 (29%)
Tryp_SPc 35..255 CDD:238113 70/243 (29%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 72/245 (29%)
Tryp_SPc 22..252 CDD:214473 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.