DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and KLK4

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:253 Identity:77/253 - (30%)
Similarity:118/253 - (46%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGIY-AVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY 77
            :||:. ::.:.|..:|:.|.|.|.:...:...|...:.      ..|.|.::....:.:||||..
Human    16 ILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENE------LFCSGVLVHPQWVLSAAHCFQ 74

  Fly    78 NREAENFLVVAG------DDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFS 136
            |    ::.:..|      |...|..   :|..|..:.|..||...:.||:.|:.:|.  .:....
Human    75 N----SYTIGLGLHSLEADQEPGSQ---MVEASLSVRHPEYNRPLLANDLMLIKLDE--SVSESD 130

  Fly   137 TMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY--YWRPISEGML 199
            |:.:|.|||:.|..|....:||||.. .||.....||.|.|.:|..|.|.:.|  .:.|   .|.
Human   131 TIRSISIASQCPTAGNSCLVSGWGLL-ANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHP---SMF 191

  Fly   200 CAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEG-CARPNYPGVYANVAYYKDWIAK 256
            |||..:..||:|.|||||||:....|.|:||:|:. |.:...||||.|:..:.:||.|
Human   192 CAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 71/235 (30%)
Tryp_SPc 28..257 CDD:238113 74/238 (31%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.