DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss22

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:279 Identity:94/279 - (33%)
Similarity:137/279 - (49%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYA-VSA------------QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTC 59
            ||.:|.||...| :||            |...|||||.|:......::|.:.:..|      ..|
Mouse    75 ILILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGS------HHC 133

  Fly    60 GGCILDAVTIATAAHCVYNR--EAENFLVVAGDDSRG--GMNGVVVRVSKLIPHELYN-SSTMDN 119
            .|.:|....:.|||||..:.  :...|.|:.|....|  |.....|.::.::||..|: ......
Mouse   134 AGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHA 198

  Fly   120 DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGL---SSDQLQQVKVPIVD 181
            |||||.::..:..........:..:|.:........|:||| :.::|:   ....||::||||:|
Mouse   199 DIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWG-SIQDGVPLPHPQTLQKLKVPIID 262

  Fly   182 SEKCQEAYYWR-----PISEGMLCAGLSEGGKDACQGDSGGPLVVANK----LAGIVSWGEGCAR 237
            ||.| ::.|||     .|:|||||||..||.:|||.|||||||:....    |.||:|||||||.
Mouse   263 SELC-KSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAE 326

  Fly   238 PNYPGVYANVAYYKDWIAK 256
            .|.||||.::..::.|:.:
Mouse   327 RNRPGVYTSLLAHRSWVQR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 84/243 (35%)
Tryp_SPc 28..257 CDD:238113 84/246 (34%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.