DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss32

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:312 Identity:94/312 - (30%)
Similarity:135/312 - (43%) Gaps:73/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLF------LLGIYAVSAQSD-----------------------GRIVGGADTSSYYTKY 41
            |.:.|:||      |||...:...||                       ||||.|.|.......:
Mouse     3 LALPAILFTFFPGVLLGSEVLPTDSDSPSTTTGRRSIDLDSVCGRPRTSGRIVSGQDAQLGRWPW 67

  Fly    42 VVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAEN-FLVVAG-------DDSRGGMNG 98
            .|.:|...      |..|||.::....:.|||||....::.: :.|:.|       |:....:..
Mouse    68 QVSVRENG------AHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPEDNEPKELRA 126

  Fly    99 VVVRVSKLIPHELYNSST-MDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYT 162
                |::.|.|..|::.. ...|||||.:..|:..:.:.....:....:....|....::|||: 
Mouse   127 ----VAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGH- 186

  Fly   163 KENGLSSDQ-------LQQVKVPIVDSEKCQEAYYWRPIS-------EGMLCAGLSEGGKDACQG 213
                :.::|       ||:::||::|:|.|...|....|.       |||||||..||.||||.|
Mouse   187 ----IGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNG 247

  Fly   214 DSGGPLVV-ANKL---AGIVSWGEGCARPNYPGVYANVAYYKDWIAKQRTSY 261
            |||||||. .|.:   ||:||||..||....||||.||:.|..||  |.|.:
Mouse   248 DSGGPLVCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWI--QNTMW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/253 (32%)
Tryp_SPc 28..257 CDD:238113 81/255 (32%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 80/253 (32%)
Tryp_SPc 54..295 CDD:238113 82/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.