DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk12

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:120/271 - (44%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVLFLLGIYAVSAQSDGRIVGGAD---------TSSYYTKYVVQLRRRSSSSSSYAQTCGGCILD 65
            ::|.||....:|.....:|..|.:         ...::.||:               .|||.::|
Mouse     4 SILLLLCAVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYL---------------RCGGVLVD 53

  Fly    66 AVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKL------------IPHELYNSS--T 116
            ...:.|||||     .:.::|..|:.|          ::||            |.|..|..:  .
Mouse    54 RKWVLTAAHC-----RDKYVVRLGEHS----------LTKLDWTEQLRHTTFSITHPSYQGAYQN 103

  Fly   117 MDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYT-KENGLSSDQLQQVKVPIV 180
            .::|:.|:.::.|:.|.  ..:..:.:.|.....|....:||||.| |......|:||.:.:..|
Mouse   104 HEHDLRLLRLNRPIHLT--RAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTV 166

  Fly   181 DSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE--GCARPNYPGV 243
            .:|.|:..:..| ::|.||||| .|.||||||||||||||....|.|:||||.  .|.:...|||
Mouse   167 SNETCRAVFPGR-VTENMLCAG-GEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGV 229

  Fly   244 YANVAYYKDWI 254
            |..|..|.|||
Mouse   230 YTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 75/252 (30%)
Tryp_SPc 28..257 CDD:238113 77/253 (30%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.