DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and LOC683849

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:253 Identity:94/253 - (37%)
Similarity:133/253 - (52%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFLLG-IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATA 72
            |.:|.|:| ..|.....|.:||||.........|.|.|      :|.| ..|||.:::...:.:|
  Rat     4 LLILALVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSL------NSGY-HFCGGSLINDQWVVSA 61

  Fly    73 AHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132
            |||..:|     ...|..|:.|::.       .|..:|:|.|..::..|::|||.|:.:..|:.|
  Rat    62 AHCYKSRIQVRLGEHNINVLEGNEQ-------FVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   133 DSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS-DQLQQVKVPIVDSEKCQEAYYWRPISE 196
            :  :.:..:.:.|.....|.|..|||||.|...|::. |.||.:..|::....| ||.|...|::
  Rat   120 N--ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADC-EASYPGKITD 181

  Fly   197 GMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|:|||..|||||:||||||||:|...:|.||||||.|||.|:.||||..|..|.|||
  Rat   182 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 86/232 (37%)
Tryp_SPc 28..257 CDD:238113 88/233 (38%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 86/232 (37%)
Tryp_SPc 24..242 CDD:238113 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.