DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:136/260 - (52%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSA---QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAV 67
            ::.|..|..||. ||:.   ..|.:||||      ||.....|..:.|.:|.| ..|||.::::.
Mouse     1 MKTLIFLAFLGA-AVALPLDDDDDKIVGG------YTCQRNALPYQVSLNSGY-HFCGGSLINSQ 57

  Fly    68 TIATAAHCVYNREAENFLVVAGDDSRGGMNG--VVVRVSKLIPHELYNSSTMDNDIALVVVDPPL 130
            .:.:||||..:|    ..|..|:.:...:.|  ..:..:|:|.|..||::|.:|||.|:.:....
Mouse    58 WVVSAAHCYKSR----IQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAA 118

  Fly   131 PLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQ-VKVPIVDSEKCQEAYYWRPI 194
            .|:  |.:..:.:....|:.|.:..:||||.|..:|.:...|.| :..|::....|..:|..: |
Mouse   119 TLN--SRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGK-I 180

  Fly   195 SEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAKQRT 259
            :..|.|.|..|||||:||||||||:|...:|.|:||||.|||:...||||..|..|.:||  |:|
Mouse   181 TSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWI--QQT 243

  Fly   260  259
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/229 (34%)
Tryp_SPc 28..257 CDD:238113 81/231 (35%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 79/229 (34%)
Tryp_SPc 25..243 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.