DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG17234

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:264 Identity:87/264 - (32%)
Similarity:122/264 - (46%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSA----QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            |.:.|.||.:..:||    :.:.||:||.........:.|.|:....      ..|||.|.....
  Fly     3 IESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGD------HVCGGSIYSENI 61

  Fly    69 IATAAHCVYNREA-----ENFLVVAGD---DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVV 125
            |.|||||.::.|.     :.:.|.||.   ||    ||.:|.|:.||.||.|......||||:|.
  Fly    62 IVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS----NGTLVDVAALIIHEEYAFDLNINDIAIVR 122

  Fly   126 VDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYT----KENGLSSDQLQQVKVPIVDSEKCQ 186
            :.  .||:..|.::.|.:|...|.....|.:||||.:    ....|....||.:.:.|.....| 
  Fly   123 LS--TPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC- 184

  Fly   187 EAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARPNYPGVYANVAYY 250
                 |.....:||||..  |:.||.|||||||||..:|.|:|||| :||....:   :.:|.|:
  Fly   185 -----RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYF 239

  Fly   251 KDWI 254
            ::||
  Fly   240 REWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/239 (33%)
Tryp_SPc 28..257 CDD:238113 80/240 (33%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/239 (33%)
Tryp_SPc 27..243 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.