DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk4

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:247 Identity:75/247 - (30%)
Similarity:123/247 - (49%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGIYAVSAQS-DGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY 77
            :|.:...||.| ..||:.|.|.|.:...:      :::..|.....|.|.::....:.:||||: 
Mouse    17 ILEVTGASASSVSSRIIQGQDCSPHSQPW------QAALFSEDGFFCSGVLVHPQWVLSAAHCL- 74

  Fly    78 NREAENFLVVAGDDSRGGMNGVVVRVSKL---IPHELYNSSTMDNDIALVVVDPPLPLDSFSTME 139
               .|:::|..|..:..|......|:.:.   |.|..:|..:..||:.|:.::..: ::| :|:.
Mouse    75 ---QESYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESV-IES-NTIR 134

  Fly   140 AIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISE-GMLCAGL 203
            :|.:|::.|..|....:||||..| ||.....||.|.:.:...|.|:..|  .|:.. .|.|||.
Mouse   135 SIPVATQCPTPGDTCLVSGWGQLK-NGKLPSLLQCVNLSVASEETCRLLY--DPVYHLSMFCAGG 196

  Fly   204 SEGGKDACQGDSGGPLVVANKLAGIVSWGEG-CARPNYPGVYANVAYYKDWI 254
            .:..||:|.||||||:|....|.|:||.|:| |.:|..|.||.|:..:.:||
Mouse   197 GQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 69/231 (30%)
Tryp_SPc 28..257 CDD:238113 70/232 (30%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.