DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and KLK10

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:213 Identity:62/213 - (29%)
Similarity:104/213 - (48%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGCILDAVTIATAAHC----VYNREA-ENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSS--- 115
            |.|.::|...:.|||||    ::.|.. ::.|::.|:..|        |.::.:.|..|:..   
Human    71 CAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLR--------RTTRSVVHPKYHQGSGP 127

  Fly   116 -----TMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQ-LQQ 174
                 |.::|:.|:.:..|:.|.  ..:.|:::.......|.|..::|||.|....:..:: |..
Human   128 ILPRRTDEHDLMLLKLARPVVLG--PRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTC 190

  Fly   175 VKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARP 238
            ..:.|:..::| |.:|...::..|:|||| :.|:|.||.|||||||....|.||:||| ..|...
Human   191 SSITILSPKEC-EVFYPGVVTNNMICAGL-DRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSA 253

  Fly   239 NYPGVYANVAYYKDWIAK 256
            .:|.||..:..|..||.|
Human   254 QHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 59/209 (28%)
Tryp_SPc 28..257 CDD:238113 62/213 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 62/213 (29%)
Tryp_SPc 49..269 CDD:214473 59/209 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.