DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk11

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:269 Identity:84/269 - (31%)
Similarity:136/269 - (50%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAV 67
            ::|||::|:..:.|    ....:.||:.|.:...:...:.|.|.:::      ...||..::...
Mouse    27 RMILRLIALALVTG----HVGGETRIIKGYECRPHSQPWQVALFQKT------RLLCGATLIAPK 81

  Fly    68 TIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVR--VSKLIPHELYNSSTMD----NDIALVVV 126
            .:.|||||    ...:::::.|:.:....:|...|  .::..||..:|:|..:    |||.||.:
Mouse    82 WLLTAAHC----RKPHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKM 142

  Fly   127 DPPLPLDSFST--MEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQ------VKVPIVDSE 183
            ..|:    |.|  ::.:.::....|.|....|||||.|     ||.||:.      ..|.|::.:
Mouse   143 SSPV----FFTRAVQPLTLSPHCVAAGTSCLISGWGTT-----SSPQLRLPHSLRCANVSIIEHK 198

  Fly   184 KCQEAYYWRP--ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEG-CARPNYPGVYA 245
            :|::||   |  |::.||||.:.:.|||:||||||||||....|.||:|||:. ||....||||.
Mouse   199 ECEKAY---PGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYT 260

  Fly   246 NVAYYKDWI 254
            .|..|.:||
Mouse   261 KVCKYFNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 77/243 (32%)
Tryp_SPc 28..257 CDD:238113 78/244 (32%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 77/243 (32%)
Tryp_SPc 48..272 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.