DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS8

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:284 Identity:83/284 - (29%)
Similarity:128/284 - (45%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSAQSDG-----------RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTC 59
            |..:|:|..||:......::|           ||.||:...:....:.|.:....      ...|
Human    12 LGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEG------VHVC 70

  Fly    60 GGCILDAVTIATAAHCV---YNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDI 121
            ||.::....:.:||||.   :::||....:.|........:..|..:..:|||..|.......||
Human    71 GGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDI 135

  Fly   122 ALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENG--LSSDQLQQVKVPIVDSEK 184
            ||:.:..|:....:.....:..|:.....|:..|::|||:...:.  |:...|||::||::..|.
Human   136 ALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET 200

  Fly   185 C----------QEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANK----LAGIVSWGEGC 235
            |          :|.::   :.|.|:|||..|||||||||||||||....:    |.||||||:.|
Human   201 CNCLYNIDAKPEEPHF---VQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDAC 262

  Fly   236 ARPNYPGVYANVAYYKDWIAKQRT 259
            ...|.||||...:.|..||..:.|
Human   263 GARNRPGVYTLASSYASWIQSKVT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 74/245 (30%)
Tryp_SPc 28..257 CDD:238113 75/247 (30%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 74/245 (30%)
Tryp_SPc 45..284 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.