DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:200 Identity:76/200 - (38%)
Similarity:108/200 - (54%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ENFLVVAGDDSRGGMNGVVVRVSK---LIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEI 143
            :..:|||||.:.|...| ..:.||   ||||.|||.||.:.||.|:.:..|:.|:.:.::..:..
Zfish     2 DQMMVVAGDYTLGANEG-TEQYSKPLMLIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPK 65

  Fly   144 ASEQPAVGVQATISGWGYTKEN-GLSSDQLQQVKVPIVDSEKC-QEAYYWRPISEGMLCAGLSEG 206
            .:.....|....:||||.|..: ||....|:.|::|||.:.|| ..:.:...|:..|:|||.|.|
Zfish    66 QNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTG 130

  Fly   207 GKDA---------------CQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256
            ||||               ||||||||||...::.|:||||.||..|.:||||..|:.::.||  
Zfish   131 GKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWI-- 193

  Fly   257 QRTSY 261
            .:|.|
Zfish   194 DQTIY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 72/191 (38%)
Tryp_SPc 28..257 CDD:238113 74/194 (38%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 74/196 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.