DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:253 Identity:89/253 - (35%)
Similarity:129/253 - (50%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIAT 71
            :.|....||.:..:......||:||.:...|..||     :.|...::| ..|||.::....:.:
Zfish     3 KCLEYTLLLIVSMLQGSKQQRIIGGQEVQPYSIKY-----QASVQYNNY-HYCGGTLIHPQWVVS 61

  Fly    72 AAHCVYNREAENFLVVAGDDSRGGMNGV--VVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDS 134
            ||||.  |.:....||..:.....:.|.  |..|||.:.|.:||..|.|:||.|:.::.|..|. 
Zfish    62 AAHCW--RPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELS- 123

  Fly   135 FSTMEAIEIASEQPAV--GVQATISGWGYTK-ENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISE 196
             :|::...:....||:  |....:||||.|: .:...|..|:.|.|.|:  .:||..||:| |::
Zfish   124 -ATIQPAVLPVSVPALQGGTVCIVSGWGVTQVYSYYLSPVLRAVDVQII--PQCQYYYYYR-ITD 184

  Fly   197 GMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|:|||...||||:|||||||||:......||||||..||...:||||..|..|..|:
Zfish   185 NMVCAGSPLGGKDSCQGDSGGPLICNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/231 (37%)
Tryp_SPc 28..257 CDD:238113 85/232 (37%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 85/230 (37%)
Tryp_SPc 24..241 CDD:238113 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.