DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:267 Identity:96/267 - (35%)
Similarity:133/267 - (49%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATA 72
            :|.:.|:....|.....|.:||||.........|.|.|      :|.| ..|||.::....:.:|
Human     4 LLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSL------NSGY-HFCGGSLISEQWVVSA 61

  Fly    73 AHCV--------------YNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMD 118
            .||.              |:|     ...|..|:.|::.       .:..:|:|.|..|||.|:|
Human    62 GHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQ-------FINAAKIIRHPKYNSRTLD 119

  Fly   119 NDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDS 182
            |||.|:.:..|..::  |.:.||.:.:..||.|.::.|||||.|..:|.. .|:||.:..|::..
Human   120 NDILLIKLSSPAVIN--SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQ 182

  Fly   183 EKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANV 247
            .:| ||.|...|:..|.|.|..|||||:||||||||:|...:|.||||||.|||:.|.||||..|
Human   183 AEC-EASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKV 246

  Fly   248 AYYKDWI 254
            ..|.|||
Human   247 YNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 90/246 (37%)
Tryp_SPc 28..257 CDD:238113 92/247 (37%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 90/246 (37%)
Tryp_SPc 24..256 CDD:238113 92/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.