DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS1

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:253 Identity:88/253 - (34%)
Similarity:130/253 - (51%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATA 72
            :|.:.|:....|.....|.:||||.:.......|.|.|      :|.| ..|||.:::...:.:|
Human   229 LLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSL------NSGY-HFCGGSLINEQWVVSA 286

  Fly    73 AHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132
            .||..:|     ...|..|:.|::.       .:..:|:|.|..|:..|::|||.|:.:.....:
Human   287 GHCYKSRIQVRLGEHNIEVLEGNEQ-------FINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVI 344

  Fly   133 DSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKCQEAYYWRPISE 196
            :  :.:..|.:.:..||.|.:..|||||.|..:|.. .|:||.:..|::...|| ||.|...|:.
Human   345 N--ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKC-EASYPGKITS 406

  Fly   197 GMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|.|.|..|||||:||||||||:|...:|.|:||||:|||:.|.||||..|..|..||
Human   407 NMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 82/232 (35%)
Tryp_SPc 28..257 CDD:238113 84/233 (36%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 82/232 (35%)
Tryp_SPc 249..467 CDD:238113 84/233 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.