DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and LOC560023

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:255 Identity:98/255 - (38%)
Similarity:134/255 - (52%) Gaps:22/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLR--RRSSSSSSYAQTCGGCILDAVTI 69
            ::|.|..:|.:....|.|. ||:||.:...|..||.|.|:  |:        ..|||.::....:
Zfish    24 QLLWVFLVLAVMVRDAFSQ-RIIGGQEVVPYSIKYQVSLQVDRK--------HFCGGTLIQPQWV 79

  Fly    70 ATAAHCVYNREAENFLVVAGDDSRGGMNGV--VVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132
            .|||||.  |.|....||..:.:.....|.  |..|:|:..|..||..|.:|||.::.:..|..:
Zfish    80 LTAAHCW--RPASVIQVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKTFNNDIMIIKLTAPAQI 142

  Fly   133 DSFSTMEAIEIASEQP--AVGVQATISGWGYTK-ENGLSSDQLQQVKVPIVDSEKCQEAYYWRPI 194
            ::: ...|:...::.|  |.|...|:||||.|: .|...|..|:.|.|.|..|  ||..||:| :
Zfish   143 NAY-VQPALLPTADTPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEIFSS--CQLYYYYR-V 203

  Fly   195 SEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            ::.|:|||...||||:|||||||||:....|.||||||.|||.|.|||||..|..|..||
Zfish   204 NDNMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKVRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 91/233 (39%)
Tryp_SPc 28..257 CDD:238113 92/234 (39%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 91/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.