DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PLAT

DIOPT Version :10

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:178 Identity:33/178 - (18%)
Similarity:62/178 - (34%) Gaps:53/178 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RETVAYMQILP-----LLLKFQD--------EKALAK-HLPRFD---NV-PRCYYAKTTLDSMES 130
            |..:..::::|     |||.|.|        |:||:: ..|.||   |: |:....:...|.::|
Human     3 RMALKKLKVIPKEGYLLLLDFDDEDDDIKVSEEALSEVKSPAFDKNENISPQAEADEDMGDEVDS 67

  Fly   131 VVIM---------------------EDLRLQAYRMWDKANPVDFEHARLLMATLGRLHALSFAMK 174
            ::..                     ||:..:...|.||:....::...:....:......||...
Human    68 MLDKSEVNNPAIGKDENISPQVKGDEDMGHEVGSMLDKSGDDIYKTLHIKRKWMETYVKESFKGS 132

  Fly   175 DQQPEEFAQCREFTDPMTKMLALDPKKTFPKMAASMCRRAIDTLEKDD 222
            :|:.|.|.:..|              :....:....|.:.|.|.:|.|
Human   133 NQKLERFCKTNE--------------RERKNINNKFCEQYITTFQKSD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 33/178 (19%)
PLATNP_000921.1 FN1 41..83 CDD:214494 7/41 (17%)
Important for binding to annexin A2 42..52 4/9 (44%)
EGF 86..117 CDD:394967 5/30 (17%)
KR 125..209 CDD:238056 11/56 (20%)
Kringle 215..296 CDD:395005
Tryp_SPc 313..559 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.